TESAMORELIN 10mg

Tesamorelin (TH-9507) is a synthetic analogue of human growth hormone-releasing factor (GRF/GHRH). The molecule is based on the 44-amino-acid sequence of human GRF and incorporates a trans-3-hexenoyl modification at the N-terminal tyrosine residue, together with a C-terminal amide. It is studied in laboratory research involving GHRH receptor signaling, growth-hormone-related pathways, peptide–receptor interactions, and endocrine molecular mechanisms.

Alph4Labs’ Tesamorelin is supplied as a research compound with batch-specific analytical documentation supporting identity, purity, and traceability. It is intended strictly for laboratory and scientific research and is not supplied as EGRIFTA or as an approved pharmaceutical product.

Scientific Name

Tesamorelin (TH-9507) — synthetic human growth hormone-releasing factor analogue

Peptide sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Structural characteristics:

• 44-amino-acid GRF analogue

• N-terminal trans-3-hexenoyl modification

• C-terminal leucinamide

The FDA describes tesamorelin as a synthetic GRF analogue containing the 44-amino-acid human GRF sequence with a hexenoyl moiety attached to the N-terminal tyrosine residue.

Specifications

• Product: Tesamorelin / TH-9507

• Quantity: 10mg

• Form: Lyophilized research compound

• CAS Number: 218949-48-5

• Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S

• Molecular Weight: 5136 g/mol

• Purity: >99% UK independent external laboratory verified*

• Storage: Refrigerated and protected from light

• Traceability: Unique batch reference

• Documentation: Batch-specific analytical verification

The molecular formula and approximately 5136 g/mol molecular weight correspond to the tesamorelin free-base molecular entity. Pharmaceutical tesamorelin is supplied as an acetate salt, and FDA documentation reports a free-base-equivalent molecular weight of approximately 5135.9 Da for tesamorelin acetate. The exact salt/form of the Alph4Labs material should therefore be matched to the applicable batch-specific CoA.

Research Grade

Tesamorelin is investigated in research involving growth hormone-releasing factor biology, GHRH receptor signaling, endocrine pathways, peptide structure, and molecular receptor interactions.

Tesamorelin has an established pharmaceutical history, including FDA-approved EGRIFTA formulations for a specific clinical indication. The Alph4Labs research product should not be represented as EGRIFTA, as an equivalent pharmaceutical formulation, or as being intended for human administration.

Highlights

• FREE Shipping on all products

• Ships within 24 hours

• >24 months shelf life*

• >99% purity — independently verified by a UK external laboratory*

• Batch-specific traceability

• Analytical documentation supporting identity and purity

• Defined 44-amino-acid peptide sequence

• Research focused on GHRH/GRF receptor signaling

• Controlled handling and storage
  

PRODUCT USE DISCLAIMER

For research purposes only.

Tesamorelin supplied by Alph4Labs is intended strictly for laboratory and scientific research. It is not intended for human or veterinary use, self-administration, consumption, diagnosis, treatment, prevention of disease, or use as a pharmaceutical, nutritional, dietary, or therapeutic product.

Alph4Labs does not represent this research product as EGRIFTA or as an FDA-approved pharmaceutical formulation. EGRIFTA products contain tesamorelin as an acetate salt and are prescription medicines with specific approved indications, formulations, safety information, and conditions of use.

*Purity, shelf life, analytical testing, storage specifications, and exact chemical form should be verified against the applicable batch-specific Certificate of Analysis (CoA).